Pay in 4 interest-free payments of $58.75 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
P290947-WB-1-P
Gene Expression Research: Enables investigation of transcriptional regulation
DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Concentration 10 U/μl Storage Buffer 50 mM Tris-HCl (pH 7
IF Host Rabbit Clone type rabbit monoclonal Target Background The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types
Phaeoramularia angolensis Probe Realtime PCR Kit 1-Step Gels P290947-WB-1-PDescription Phaeoramularia angolensis Probe Realtime PCR Kit is a PCR kit intended for research use in nucleic acid analysis under controlled laboratory conditions using probe based real time PCR. Purified DNA is directly amplified using sequence specific primers and probes. During amplification, fluorescence signals are generated through probe cleavage, allowing real time monitoring of amplification. The resulting signals may be used for comparative
US$ 28.64
US$ 78.09
US$ 52.79
US$ 55.09
US$ 149.39
US$ 103.39
US$ 55.09
US$ 37.84
US$ 127.54